PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GRAS
Protein Properties Length: 593aa    MW: 67472.8 Da    PI: 5.349
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28195genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.63.7e-952155902374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaa 80 
                                 e Ll+cAe v  +++e+a+++L++++ l+s++g+p++R+++yf+eAL++r+ +++ +++  ++  +++e+      +++ l+ 
  Tp57577_TGAC_v2_mRNA28195 215 AESLLTCAEKVGYQQFERARKVLSQIESLSSKTGNPVKRVVHYFAEALRQRIDKETGRVS--INNMQKKESLfdpeaETKDLNP 296
                                578***************************************************555554..3333333333223333333333 PP

                       GRAS  81 lkl.fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg.skeeleet 161
                                + + f e  P+ k++ +t+ qa+ e v  ++++H+iD+ i +GlQ + L+qaL sR+e p   l+iT+++s +++ sk ++e t
  Tp57577_TGAC_v2_mRNA28195 297 TLVaFIEDLPFCKVAMFTCVQALIENVTDAKKIHVIDLAIRKGLQLAILMQALQSRNECPLeLLKITAIESGNTDtSKLAVEDT 380
                                3337*****************************************************7665499*******99889******** PP

                       GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                                g+rL++fA++l++pf+f++++++++ +l+ ++++++++E++aV ++++l    ++s +le     v++++++++P+v+vv+e e
  Tp57577_TGAC_v2_mRNA28195 381 GKRLKEFAQSLNIPFSFDIIIVSDWLNLREDHFKIDSDETVAVYSQFALRCKIQQSDQLET----VMRVIRTINPTVMVVAEIE 460
                                *************************************************999988888887....******************* PP

                       GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329
                                a+hns+sF++rf+eal y+sa+fd+le  +  ++++r+ +E ++++  i+n va egaer+ r+ +   Wr+ ++++G+ + +l
  Tp57577_TGAC_v2_mRNA28195 461 ANHNSKSFVNRFIEALFYFSAFFDCLEDCMKGDEKNRMIMESMYFSHGIRNNVAEEGAERKSRNVKIDVWRAFFSRFGMVETKL 544
                                ************************************************************************************ PP

                       GRAS 330 sekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                s     qa+l+ ++++ +   + + + ++l+ gWk+ p+ svS+W+
  Tp57577_TGAC_v2_mRNA28195 545 SMISLYQAELVAKRFScGSSCTFDMNGHCLLVGWKGTPINSVSVWK 590
                                ****************9888999999*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.336188569IPR005202Transcription factor GRAS
PfamPF035141.3E-92215590IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MENFCNFGEI SFSAIEDKLS SSNDTFWHTK KVTAMKNVEF SVAEDQGDHN GIESLRSNFG  60
FFPQEEELLL STNQQKFHHQ DYEPFDNLQF DMVQFDEQFE TKTLPLCDKK KDKQYYQNTP  120
LAAPVEILKN YGKGFKRLLP DEGKILHPVS DFGLVTDNEN ERKFSTTDIM KIAGTKFIQS  180
SSSSDHSASG LILNHPFGFS FSGLSDEEKE DISLAESLLT CAEKVGYQQF ERARKVLSQI  240
ESLSSKTGNP VKRVVHYFAE ALRQRIDKET GRVSINNMQK KESLFDPEAE TKDLNPTLVA  300
FIEDLPFCKV AMFTCVQALI ENVTDAKKIH VIDLAIRKGL QLAILMQALQ SRNECPLELL  360
KITAIESGNT DTSKLAVEDT GKRLKEFAQS LNIPFSFDII IVSDWLNLRE DHFKIDSDET  420
VAVYSQFALR CKIQQSDQLE TVMRVIRTIN PTVMVVAEIE ANHNSKSFVN RFIEALFYFS  480
AFFDCLEDCM KGDEKNRMIM ESMYFSHGIR NNVAEEGAER KSRNVKIDVW RAFFSRFGMV  540
ETKLSMISLY QAELVAKRFS CGSSCTFDMN GHCLLVGWKG TPINSVSVWK FI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402165906375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1445390.0AC144539.7 Medicago truncatula clone mth2-11o10, complete sequence.
GenBankAC1521850.0AC152185.1 Medicago truncatula chromosome 2 clone mth2-97e5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594755.10.0GRAS family transcription factor
TrEMBLA2Q2X90.0A2Q2X9_MEDTR; GRAS family transcription factor
STRINGGLYMA15G15110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-57RGA-like 2